Server Description
AS2TS service is designed to facilitate the construction of 3D models for a given list of protein sequences.
For AS2TS processing each protein sequence of amino-acids should be entered in FASTA format.
A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column (see an example below): >NameOfTheProtein RKNGLNVKMDYTPNSGQLVRNLLNGKYNIAVAGIDNVIAYQEGQVKEPVVNPDMFAFYGV KELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYK
Short description of the type of results generated by the system is here.
This system was used to generate results described in the following publication:
K. E. Wheeler, A. Zemla, Y. Jiao, D. S. Aliaga Goltsman, S. W. Singer SW,
J. F. Banfield, M. P. Thelen: "Functional Insights from Computational Modeling of
Orphan Proteins Expressed in a Microbial Community" Journal of Proteomics and
Bioinformatics, 2010, 3: 266-274.doi:10.4172/jpb.1000150
[JPB]